PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g24370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 291aa    MW: 32367.3 Da    PI: 6.6495
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g24370genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.3e-33149206259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  Tp5g24370 149 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSEDPSIVITTYEGQHCHQ 206
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-34133207IPR003657WRKY domain
SuperFamilySSF1182902.62E-28140206IPR003657WRKY domain
PROSITE profilePS5081129.539143208IPR003657WRKY domain
SMARTSM007749.6E-39148207IPR003657WRKY domain
PfamPF031063.6E-26149206IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MNDPENPDLS NDDSAWTQLT APDSDFFDRD TSSNILSDFA WNLHTSSDHH HSLRFDSALT  60
QTPSVRSTTA TPDSIIPSSS STSSSAAVTE VSASNNVPSA TSSSSEDPTD NSTAAKTPET  120
PKKEKKKAQK RIRQPRFAFM TKSDVENLED GYRWRKYGQK AVKNSPFPRS YYRCTNSRCT  180
VKKRVERSSE DPSIVITTYE GQHCHQTIGF PRGGILTAHD PRHFTSHHHL PPPLPNPYYY  240
QELLDQLHRD NTSSPRLPQS NPEDGPAAVS SINPSEEGLL GDIVPQTMRN P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-25138205774Probable WRKY transcription factor 4
2lex_A3e-25138205774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300640.0KF430064.1 Brassica rapa WRKY transcription factor 57 (WRKY57) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588933.11e-159PREDICTED: probable WRKY transcription factor 57
RefseqXP_013588934.11e-159PREDICTED: probable WRKY transcription factor 57
RefseqXP_013588935.11e-159PREDICTED: probable WRKY transcription factor 57
RefseqXP_013700904.11e-159PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9831e-139WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A078HQM01e-159A0A078HQM0_BRANA; BnaC06g30480D protein
TrEMBLA0A0D3CZ751e-159A0A0D3CZ75_BRAOL; Uncharacterized protein
STRINGBra004370.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49952753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-121WRKY DNA-binding protein 57